Recombinant Bartonella tribocorum ATP synthase subunit b 1 (atpF1)
This Recombinant Bartonella tribocorum ATP synthase subunit b 1 (atpF1) spans the amino acid sequence from region 1-188.
Product Specifications
Product Name Alternative
ATP synthase subunit b 1, ATP synthase F (0) sector subunit b 1, ATPase subunit I 1, F-type ATPase subunit b 1, F-ATPase subunit b 1
UniProt
A9IQI5
Expression Region
1-188
Origin
Bartonella tribocorum (strain CIP 105476 / IBS 506)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFIASAYAQNTETSIEHIKKVAEHANRVFPPFDFVHFSSHFFWLAISFGFFYLFISRVIA PRIGGVIETRRDRIASDLDQAMRMKQEADTVVETYERELAEARLKAHTIAQAAGEELKQK AELERKEIEERLEKKLADAEKQIAKIRDKAMQNVGSIAEEVTLGIVKKLIDVDINKETVR SVIKTANY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681081-100 1x 100 µL
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400040-100 1x 100 µL
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 