Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Talaromyces stipitatus Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

This Recombinant Talaromyces stipitatus Altered inheritance of mitochondria protein 31, mitochondrial (aim31) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 31, mitochondrial

UniProt

B8MJJ2

Expression Region

1-188

Origin

Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADQADLLESPQFEEETSMQKFKRRLKEEPLIPLGCAATCYALYRAYRSGKAKDSVEMNR MFRARIYAQFFTLLAVVAGGMYYKTERKQRREFERKVEERKAQEKRDAWLRELEAREKED KGWRERHAAVSEAANNPVGVSAVVAGKKEEEEKGVDGNVNQAPQEEGGVKRGTGILDAVK ALVRGKKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-100 1x 100 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-500 1x 500 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006), CF568 conjugate, 0.1mg/mL
BNC680006-100 1x 100 µL

Bcl-x (BX006), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (LAMP3/968), CF405S conjugate, 0.1mg/mL
BNC040968-500 1x 500 µL

CD63 (LAMP3/968), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details