Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

O68611

Expression Region

1-188

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAQVTTSTDKVLRQPILGSRRFSNMLWASVSAIGGIGFLLAGLSSYFHKNLLGVSDPSN IQFIPQGAALTFYGVAGTLLSAYLWFVFFLDVGGGYNEFNKETGKVTIFRNGFVGKNRII NFQYPLKDILSIRAEIKEGLNPRRVLYLRVKNRGDIPLNRVGEPIPLAELENQGAELARF LTIPLEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIFY11A Rabbit Polyclonal Antibody
HA500265 100 µL

TIFY11A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CISH Rabbit Polyclonal Antibody
TA365367 100 µL

CISH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACAP3 (NM_030649) Human Over-expression Lysate
LY432394 100 µg

ACAP3 (NM_030649) Human Over-expression Lysate

Sign In for Pricing
View Details
3,4-Diaminobenzenesulfonic Acid
TRC-D415015-50MG 50 mg

3,4-Diaminobenzenesulfonic Acid

Sign In for Pricing
View Details
4-Hydroxyphenylacetic Acid
TRC-H949060-25G 25 g

4-Hydroxyphenylacetic Acid

Sign In for Pricing
View Details
1,5-Diazido-3-oxapentane
TRC-D417280-500MG 500 mg

1,5-Diazido-3-oxapentane

Sign In for Pricing
View Details