Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus elongatus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Synechococcus elongatus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q31QI3

Expression Region

1-188

Origin

Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSPVATVETDSLQQPILGSRRPSNYFWAIAVSVGGTGLLLAGLSSYLQVNLLPFSEPTR LAFLPQGLVMGLYGIAAILLASYLWFVISLDVGGGYNAFDRKTQKATIFRWGFPGKNRRV EITYPLSDIQAVRVDIKEGLNPKRALYLKVKGRGDVPLTRVGQPLPLTELESQGAELARF LAVPLEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-100 1x 100 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-500 1x 500 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/765), CF640R conjugate, 0.1mg/mL
BNC400765-100 1x 100 µL

Chromogranin A (CHGA/765), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details