Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zygnema circumcarinatum ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Zygnema circumcarinatum ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q32RL0

Expression Region

1-188

Origin

Zygnema circumcarinatum (Green alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGERIKSTMDLLIYLQNSHLATGFGFNTNLFETNLINLAVVIGVLVYFGKGVLTTLLNNR KETIVNTIRDAEERYQEATEKLNKAYTRLEQAKAKAEEIRVNGLAQMEIEKQELIKAADE DSKRLEDSKNATLRFEEQRAIEQVRQQVSRLALELALETLKTRLNRDLHAQMIDYHIGLL QSMESVID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-500 1x 500 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-100 1x 100 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF740 conjugate, 0.1mg/mL
BNC741628-500 1x 500 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details