Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma hyopneumoniae ATP synthase subunit b (atpF)

This Recombinant Mycoplasma hyopneumoniae ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q4A8W3

Expression Region

1-188

Origin

Mycoplasma hyopneumoniae (strain 7448)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVNLNQSLGDLFKGIIPNVYVLGATIVSFLVLFLFITYFVYRPLKKYIKKRKDFLQNHID LTIKSNVEAEKLEKKSQQKLLETKEFCIELKEKSQIEANKFLEDAKKTAIDNARQLINEG QKVLLEYENEIKSKYYMNVINVAVEICQKYLEKQDKNNKILQQSLIADLEKELRKRENSS KKKDNFGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF488A conjugate, 0.1mg/mL
BNC880675-500 1x 500 µL

Cytokeratin 6 (LHK6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF488A conjugate, 0.1mg/mL
BNC881859-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (IGEL/773), CF568 conjugate, 0.1mg/mL
BNC680773-100 1x 100 µL

CD20 (IGEL/773), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF405S conjugate, 0.1mg/mL
BNC040948-500 1x 500 µL

Cytokeratin 5/8 (C-50), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details