Recombinant Xenopus laevis Uncharacterized protein C17orf62 homolog
This Recombinant Xenopus laevis Uncharacterized protein C17orf62 homolog spans the amino acid sequence from region 1-188.
Product Specifications
Product Name Alternative
Uncharacterized protein C17orf62 homolog
UniProt
Q5HZS2
Expression Region
1-188
Origin
Xenopus laevis (African clawed frog)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MYMQVESRTGTLLHLKRNPSIRSWSLLVGILSVGLAAAYYSTDTWLWKLFYVAGCAFVAL QNLEDWEEAVFDKKSGKAILTTYSIYKKLLTLCKGGQDQVVVLLKEIRDVNVAEERVRYF GKGYVIVLRFVTGISHPLTQSAVLGARSDVEAVAKELTKFLELDLVRTRSQAVEESSDSE SDGALDKQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940270-100 1x 100 µL
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470500-500 1x 500 µL
Progesterone Receptor (PR500), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401783-100 1x 100 µL
CD45RB (B-Cell Marker) (PTPRC/1783R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682460-100 1x 100 µL
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details