Recombinant Xenopus laevis Selenoprotein S B (sels-b)
This Recombinant Xenopus laevis Selenoprotein S B (sels-b) spans the amino acid sequence from region 1-188.
Product Specifications
Product Name Alternative
Selenoprotein S B, SelS B
UniProt
Q68EU0
Expression Region
1-188
Origin
Xenopus laevis (African clawed frog)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MELGNQPGQGNRPEIELEWYQYLQNTVGEALSNYGWYILLGCIVIYFLIQKLSANFTRAV ASTRTTVTDPDEIVRRQEAVAAARMRMQVELNAQAELYKQKQVQLQEEKRRRNIETWDRM QEGKSSKVGCRLVQDASPRTSTSSSAPKPKPESRPLRDSGYNPLTGGGGGTCAWRPGRRG PSSGGSUG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740270-100 1x 100 µL
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details