Recombinant Gloeobacter violaceus Photosystem I assembly protein Ycf4 (ycf4)
This Recombinant Gloeobacter violaceus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-188.
Product Specifications
Product Name Alternative
Photosystem I assembly protein Ycf4
UniProt
Q7NPH6
Expression Region
1-188
Origin
Gloeobacter violaceus (strain PCC 7421)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAAPAIYQTDKVLRFEVPGSRRPSTYFFALVLTLGGLGFLFAGLSPFVETNLLPFSDTRG LTRFPQGVTMIFYGALATLFSLYYWLVLALDVGSGYNEFDKQNKKVTLFRRGFPGKNRII EIVHPLENILGLKVQIKEGLNPRRAYFLKLKGARDLRLSPVGQPQPLAAVEDQVSAIARF LNIGVEGI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682809-500 1x 500 µL
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740634-100 1x 100 µL
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941706-100 1x 100 µL
S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880532-500 1x 500 µL
Cytokeratin 14 (KRT14/532), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940970-500 1x 500 µL
GLG1 (Golgi Complex) (GLG1/970), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details