Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum ATP synthase subunit b (atpF)

This Recombinant Corynebacterium glutamicum ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q79VG9

Expression Region

1-188

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANSIYNLAQADALPLESGNSILFPPLYDIVWSLIPFLIILIVFWKLVLPKFQEVLTERE DRIKGGIQRAEAAQAEAKAALEKYNAQLAEARTEAAEIREQARERGKQIEAELKDKANEE SNRIIESGSKQLLAQREQVVNELRREMGQNSINLAEHLLGDQLSDNVKRSGTIDRFLADL DTVAPNGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (1415-1), CF594 conjugate, 0.1mg/mL
BNC940580-100 1x 100 µL

Histone H1 (1415-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FLAP (ALOX5AP) (NM_001629) Human Over-expression Lysate
LY400611 100 µg

FLAP (ALOX5AP) (NM_001629) Human Over-expression Lysate

Sign In for Pricing
View Details
PerCP Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112F-01 50 Tests

PerCP Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
PerCP Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112F-02 100 Tests

PerCP Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
PerCP Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112F-03 2x 100 Tests

PerCP Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1961), Biotin conjugate, 0.1mg/mL
BNCB1961-100 1x 100 µL

Tryptase (Mast Cell Marker) (TPSAB1/1961), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details