Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Protein RER1 (RER1)

This Recombinant Saccharomyces cerevisiae Protein RER1 (RER1) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

Protein RER1, Retention of ER proteins 1

UniProt

P25560

Expression Region

1-188

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYDSSDTMNGGSSNPLITKMNTMKLLYQHYLDKVTPHAKERWAVLGGLLCLFMVRITMA EGWYVICYGLGLFLLNQFLAFLTPKFDMSLQQDEENNELEAGEKSEEFRPFIRRLPEFKF WYNSIRATVISLLLSLFSIFDIPVFWPILLMYFILLFFLTMRRQIQHMIKYRYIPLDIGK KKYSHSSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ephrin A5 (EFNA5) Rabbit Polyclonal Antibody
AP20527PU-N 100 µg

Ephrin A5 (EFNA5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human OR2C1 activation kit by CRISPRa
GA103329 1 Kit

Human OR2C1 activation kit by CRISPRa

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Rabbit Polyclonal Antibody to Rat IgG
PA-2362-1 1 mL

Horseradish Peroxidase Conjugated Rabbit Polyclonal Antibody to Rat IgG

Sign In for Pricing
View Details
Tissue Total RNA, Ileum
CR560340 5 µg

Tissue Total RNA, Ileum

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560181 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
CCDC154 (NM_001143980) Human Over-expression Lysate
LY428440 100 µg

CCDC154 (NM_001143980) Human Over-expression Lysate

Sign In for Pricing
View Details