Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum ATP synthase subunit b (atpF)

This Recombinant Corynebacterium glutamicum ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A4QDG9

Expression Region

1-188

Origin

Corynebacterium glutamicum (strain R)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANSIYNLAHADALPLESGNSILFPPLYDIVWSLIPFLIILIVFWKLVLPKFQEVLTERE DRIKGGIQRAEAAQAEAKAALEKYNAQLAEARTEAAEIREQARERGKQIEAELKDKANEE SNRIIESGSKQLLAQREQVVNELRREMGQNSINLAEHLLGDQLSDNVKRSGTIDRFLADL DTVAPNGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POTEF (Center) Rabbit Polyclonal Antibody
AP53396PU-N 400 µL

POTEF (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MIF4GD (NM_020679) Human Over-expression Lysate
LY402799 100 µg

MIF4GD (NM_020679) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Nhlh2 activation kit by CRISPRa
GA202901 1 Kit

Mouse Nhlh2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Araf activation kit by CRISPRa
GA200260 1 Kit

Mouse Araf activation kit by CRISPRa

Sign In for Pricing
View Details
BLAP75 (RMI1) Human Gene Knockout Kit (CRISPR)
KN208030RB 1 Kit

BLAP75 (RMI1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
psi-Tropine
TRC-T892660-1G 1 g

psi-Tropine

Sign In for Pricing
View Details