Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clavibacter michiganensis subsp. michiganensis ATP synthase subunit b (atpF)

This Recombinant Clavibacter michiganensis subsp. michiganensis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A5CQ56

Expression Region

1-188

Origin

Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTPHNVMAAGEEAPSILLPAVYDIVWSAVVFVVLLVVIWKYALPRVYAMLDGRTEAIAG GIEKAERAQAEADAAKAELTAQLAEARAEAGRIREQARVDATAIAAEIKEQATADAARIT ASAQQQIEAERQQAVVSLRSEVGSLAIDLASGVIGQSLTDDQRSTALVDRFLADLEASET AGRTGSAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-100 1x 100 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF488A conjugate, 0.1mg/mL
BNC880287-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), CF647 conjugate, 0.1mg/mL
BNC471840-100 1x 100 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details