Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kineococcus radiotolerans ATP synthase subunit b (atpF)

This Recombinant Kineococcus radiotolerans ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A6W7G5

Expression Region

1-188

Origin

Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVAAFAAAGEEVEGNPTYPILPHLGELIVGIIFAIIIYAVIAKKVVPRLEAMYEERRAA IEGNVEKAEKAQAEAQVALEQYKAQLADARGEANRIREEARQQGAQILAEMREQAQAESE RITTAARATIEAERVQATAQLRAEVGRLATDLAGRIVGESLQDSARQSGVVDRFLADLER SESGASSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Soft tissue
CS808251 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
C11orf74 (C-term) Rabbit Polyclonal Antibody
AP50438PU-N 400 µL

C11orf74 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospholipase D1 (PLD1) Rabbit Polyclonal Antibody
AP20265PU-N 100 µg

Phospholipase D1 (PLD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/2122), CF640R conjugate, 0.1mg/mL
BNC402122-100 1x 100 µL

Ubiquitin (Autophagy Marker) (UBB/2122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS700714 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
FLRT1 (NM_013280) Human Recombinant Protein
TP720302 10 µg

FLRT1 (NM_013280) Human Recombinant Protein

Sign In for Pricing
View Details