Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kineococcus radiotolerans ATP synthase subunit b (atpF)

This Recombinant Kineococcus radiotolerans ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A6W7G5

Expression Region

1-188

Origin

Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVAAFAAAGEEVEGNPTYPILPHLGELIVGIIFAIIIYAVIAKKVVPRLEAMYEERRAA IEGNVEKAEKAQAEAQVALEQYKAQLADARGEANRIREEARQQGAQILAEMREQAQAESE RITTAARATIEAERVQATAQLRAEVGRLATDLAGRIVGESLQDSARQSGVVDRFLADLER SESGASSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Bpgm activation kit by CRISPRa
GA200437 1 Kit

Mouse Bpgm activation kit by CRISPRa

Sign In for Pricing
View Details
CDCP1 Antibody (HRP)
KH-4007-01 50 μL

CDCP1 Antibody (HRP)

Sign In for Pricing
View Details
CDCP1 Antibody (HRP)
KH-4007-02 100 µL

CDCP1 Antibody (HRP)

Sign In for Pricing
View Details
CDCP1 Antibody (HRP)
KH-4007-03 1 mL

CDCP1 Antibody (HRP)

Sign In for Pricing
View Details
Fluorescein-5-Maleimide
#91028 1x 25 mg

Fluorescein-5-Maleimide

Sign In for Pricing
View Details
Recombinant GRSF1 Antibody
RC-5731-01 50 μL

Recombinant GRSF1 Antibody

Sign In for Pricing
View Details