Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Synechocystis sp. Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

P72705

Expression Region

1-188

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGQTLAESSQVLRQEVLGARRFSNFFWAGISTIGGVGFLLAGLSSYFGKNLLIVSDTTG LQFIPQGVALLFYGVAGSTVAGYLWLTMALNVGSGYNEFNKKSGQVTIFRWGFPGKNRRI ELINKIADVQAVKAEIKEGVNPKRSLYLKVKQRRDIPLTRAGQPISLSQLENQGAELARF LGVPLEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-100 1x 100 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-100 1x 100 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-100 1x 100 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF594 conjugate, 0.1mg/mL
BNC940396-100 1x 100 µL

Ep-CAM / CD326 (323/A3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF594 conjugate, 0.1mg/mL
BNC940418-500 1x 500 µL

Fascin-1 (FSCN1/418), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details