Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc punctiforme Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Nostoc punctiforme Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

B2J2W1

Expression Region

1-189

Origin

Nostoc punctiforme (strain ATCC 29133 / PCC 73102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSTTINKGDRLLHQNVLGSRRFSNYWWATIVTLGASGFLLAGISSYLKVNLLIVSDPT QLVFVPQGLVMGLYGAAGLLLATYLWLVILLDVGGGYNEFNQETGTIKIFRWGFPGKNRR IEIDSRIEDVQSVRIAVKEGLNPIRALYLRIKGRRDIPLTRVGQPLSLTELETEGAKLAR FLGVSLEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CST3 Monoclonal Antibody
E-AB-22129-01 20 µL

CST3 Monoclonal Antibody

Sign In for Pricing
View Details
CST3 Monoclonal Antibody
E-AB-22129-02 60 µL

CST3 Monoclonal Antibody

Sign In for Pricing
View Details
CST3 Monoclonal Antibody
E-AB-22129-03 120 µL

CST3 Monoclonal Antibody

Sign In for Pricing
View Details
CST3 Monoclonal Antibody
E-AB-22129-04 200 µL

CST3 Monoclonal Antibody

Sign In for Pricing
View Details
Accuris qMAX Green One-Step RT-qPCR Kit, High Rox, 1000 reactions
PR2120-H-1000 1 Each

Accuris qMAX Green One-Step RT-qPCR Kit, High Rox, 1000 reactions

Sign In for Pricing
View Details
1,2-Hexanediol
TRC-H294245-10G 10 g

1,2-Hexanediol

Sign In for Pricing
View Details