Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Transmembrane protein 85 (tmem85)

This Recombinant Danio rerio Transmembrane protein 85 (tmem85) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Transmembrane protein 85

UniProt

Q6P011

Expression Region

1-189

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSSAGQGGGALSTRGGAATKRMKWAVELSLGNSRSRSDRQGKDGDVMYPVGYSDKPVPD TSVQEADRNLVEKRCWDVALGPLKQIPMNLFIMYMSGNTISIFPIMMVCMMAWRPIQALM SMSATFKLLESSSQQWLQGLVYLIGNLLGSALAIYKCQSMGLLPTHSSDWLAFIEPPQRL EIMGGGMVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal sequence receptor delta (SSR4) (NM_006280) Human Over-expression Lysate
LC401891 20 µg

Signal sequence receptor delta (SSR4) (NM_006280) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage: tibia, proximal
CS712708 5x 5 µm

Tissue FFPE Sections, Cartilage: tibia, proximal

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF740 conjugate, 0.1mg/mL
BNC741471-500 1x 500 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Puromycin-D3 Dihydrochloride
TRC-P840322-2.5MG 2.5 mg

Puromycin-D3 Dihydrochloride

Sign In for Pricing
View Details
Polystyrene PHB cMAP 8 branch
JH2013-8.1G 1 g

Polystyrene PHB cMAP 8 branch

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (rATG5/2553), Biotin conjugate, 0.1mg/mL
BNCB3642-500 1x 500 µL

ATG5 (Autophagy Marker) (rATG5/2553), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details