Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q2JHG9

Expression Region

1-189

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAIVPEIRSADLLRYTVIGSRRPSVYFWAVALTGGGLGFTLAGLSSYLHRNLLPFSDPA SLVFIPQGIAMLFYGVLGSLAGLYQWLSLYWNLGGGYNEFDRRTQKITLVRQGFPGKNRE VRLEYDFADVQSLRVELREGLNPRRAIYLRVKGRGDIPLTGVGQPPPLTEIENQAAEIAR FLNVSLEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ac-VDVAD-AFC
HY-P2615 1 Each

Ac-VDVAD-AFC

Sign In for Pricing
View Details
PCP4 Rabbit Polyclonal Antibody (AP)
orb870161 100 µL

PCP4 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Bak Rabbit mAb
MBS8602434-01 0.1 mL

Bak Rabbit mAb

Sign In for Pricing
View Details
Bak Rabbit mAb
MBS8602434-02 0.1 mL (AF405L)

Bak Rabbit mAb

Sign In for Pricing
View Details
Bak Rabbit mAb
MBS8602434-03 0.1 mL (AF405S)

Bak Rabbit mAb

Sign In for Pricing
View Details
Bak Rabbit mAb
MBS8602434-04 0.1 mL (AF610)

Bak Rabbit mAb

Sign In for Pricing
View Details