Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b, chloroplastic (atpF)

This Recombinant ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q8MA06

Expression Region

1-189

Origin

Chaetosphaeridium globosum

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIYMNIEKIFSIALKTWPIGNSFAINTNILETNLINLGVVLAILVYFGKGILSNLLENR KQNILSTIRDAEQCYQEAAAKLKQAKLRLEQAKLKADEIRIQGLAQLEREKLELIKAADE DSKRLEESKNVTIRFEQQRAIEQVRQQVSRLALERALETLNNSLNPDLQARIIDNHIGLL RTIEGVTES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Aminobenzylcyanide
TRC-A596920-2.5G 2.5 g

2-Aminobenzylcyanide

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2910), CF568 conjugate, 0.1mg/mL
BNC682910-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2910), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP10 (NM_002425) Human Over-expression Lysate
LC400867 20 µg

MMP10 (NM_002425) Human Over-expression Lysate

Sign In for Pricing
View Details
RAD51D Rabbit Polyclonal Antibody
AP01250PU-N 100 µg

RAD51D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNFSF10 Antibody
KC-8166-01 50 μL

TNFSF10 Antibody

Sign In for Pricing
View Details
TNFSF10 Antibody
KC-8166-02 100 µL

TNFSF10 Antibody

Sign In for Pricing
View Details