Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Receptor expression-enhancing protein 5 (Reep5)

This Recombinant Rat Receptor expression-enhancing protein 5 (Reep5) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 5, Polyposis locus protein 1 homolog

UniProt

B2RZ37

Expression Region

1-189

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCN LIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLKCGF LLWCMAPSPSNGAELLYRRVIRPIFLKHESQVDSVVKDVKDKAKETADAISKEVKKATVN LLGDEKKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRPK1 Antibody
MBS9605929-01 0.1 mL

SRPK1 Antibody

Sign In for Pricing
View Details
SRPK1 Antibody
MBS9605929-02 0.2 mL

SRPK1 Antibody

Sign In for Pricing
View Details
SRPK1 Antibody
MBS9605929-03 5x 0.2 mL

SRPK1 Antibody

Sign In for Pricing
View Details
SOCS1 Antibody (N-term)
MBS9210758-01 0.08 mL

SOCS1 Antibody (N-term)

Sign In for Pricing
View Details
SOCS1 Antibody (N-term)
MBS9210758-02 0.4 mL

SOCS1 Antibody (N-term)

Sign In for Pricing
View Details
SOCS1 Antibody (N-term)
MBS9210758-03 5x 0.4 mL

SOCS1 Antibody (N-term)

Sign In for Pricing
View Details