Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnetococcus sp. ATP synthase subunit b (atpF)

This Recombinant Magnetococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A0LDW8

Expression Region

1-189

Origin

Magnetococcus sp. (strain MC-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISAAYAATHAAAEHAQSGMPQFDSSTFSSQMFWTVISFVALLLLLKKFVVPAISDVLEA RASRIEEELKAAENERKEAAALLVDQRAEVKAEREKIAQLLESARKEADALREQEKAELE AELAKLKSQATQDIEQARRQAMSEVRGVVVEVALAVTEKLITKSIDKAEANKLADEAIRH LEANKDQLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casein Kinase 1 alpha (CSNK1A1) (NM_001025105) Human Tagged Lenti ORF Clone
RC217936L1 10 µg

Casein Kinase 1 alpha (CSNK1A1) (NM_001025105) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Histone H1.0 Antibody (YA384, Rabbit)
HY-P80157-01 10 µL

Histone H1.0 Antibody (YA384, Rabbit)

Sign In for Pricing
View Details
Histone H1.0 Antibody (YA384, Rabbit)
HY-P80157-02 50 μL

Histone H1.0 Antibody (YA384, Rabbit)

Sign In for Pricing
View Details
Histone H1.0 Antibody (YA384, Rabbit)
HY-P80157-03 100 µL

Histone H1.0 Antibody (YA384, Rabbit)

Sign In for Pricing
View Details
ACSVL3 shRNA (h) Lentiviral Particles
sc-78881-V 200 µL

ACSVL3 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
PDE1B Polyclonal Antibody, RBITC Conjugated
bs-9968R-RBITC 100 µL

PDE1B Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details