Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnetococcus sp. ATP synthase subunit b (atpF)

This Recombinant Magnetococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A0LDW8

Expression Region

1-189

Origin

Magnetococcus sp. (strain MC-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISAAYAATHAAAEHAQSGMPQFDSSTFSSQMFWTVISFVALLLLLKKFVVPAISDVLEA RASRIEEELKAAENERKEAAALLVDQRAEVKAEREKIAQLLESARKEADALREQEKAELE AELAKLKSQATQDIEQARRQAMSEVRGVVVEVALAVTEKLITKSIDKAEANKLADEAIRH LEANKDQLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen VII Polyclonal Antibody, PerCP Conjugated
bs-1558R-PerCP-TR 20 µL

Collagen VII Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
AKR7A2 (NM_003689) Human 3' UTR Clone
SC203519 10 µg

AKR7A2 (NM_003689) Human 3' UTR Clone

Sign In for Pricing
View Details
SEMA6D Protein Vector (Mouse) (pPB-C-His)
PV227682 500 ng

SEMA6D Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
hsa-miR-19a Primers
MPH01242 150 µL - 10 µM

hsa-miR-19a Primers

Sign In for Pricing
View Details
HRP-3 Polyclonal Conjugated Antibody
orb1618260 100 µL

HRP-3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
PLSCR3 (NM_020360) Human Tagged ORF Clone
RC210587 10 µg

PLSCR3 (NM_020360) Human Tagged ORF Clone

Sign In for Pricing
View Details