Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nocardioides sp. ATP synthase subunit b (atpF)

This Recombinant Nocardioides sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A1SHI7

Expression Region

1-189

Origin

Nocardioides sp. (strain BAA-499 / JS614)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQALLAAPLAKAEELNPLLPHAIEIVLSLVVFGLLLFAVWKFVTPRFEQIYTERTQAIEG GLAAAETKQAEADAKLADLEQQLSEARHEAARIREEAREQGAQIIAEMREQAQADAARIV EHGKTQIEAERQQAVTSLRAEVGTLATSLAGRIVGESLEDDDRSARVVERFLADLETIEA SQAAGGGES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella sonnei Probable crotonobetaine/carnitine-CoA ligase (caiC), partial
MBS1427389 Inquire

Recombinant Shigella sonnei Probable crotonobetaine/carnitine-CoA ligase (caiC), partial

Sign In for Pricing
View Details
Cox8c ORF Vector (Mouse) (pORF)
16729014 1.0 µg DNA

Cox8c ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Cluster Of Differentiation 72 (CD72)
SIPB944Hu01-01 10 µg

Recombinant Cluster Of Differentiation 72 (CD72)

Sign In for Pricing
View Details
Recombinant Cluster Of Differentiation 72 (CD72)
SIPB944Hu01-02 50 µg

Recombinant Cluster Of Differentiation 72 (CD72)

Sign In for Pricing
View Details
Recombinant Cluster Of Differentiation 72 (CD72)
SIPB944Hu01-03 200 µg

Recombinant Cluster Of Differentiation 72 (CD72)

Sign In for Pricing
View Details
Recombinant Cluster Of Differentiation 72 (CD72)
SIPB944Hu01-04 1 mg

Recombinant Cluster Of Differentiation 72 (CD72)

Sign In for Pricing
View Details