Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Copper transport protein CTR2 (CTR2)

This Recombinant Saccharomyces cerevisiae Copper transport protein CTR2 (CTR2) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Copper transport protein CTR2, Copper transporter 2

UniProt

P38865

Expression Region

1-189

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDDKKTWSTVTLRTFNQLVTSSLIGYSKKMDSMNHKMEGNAGHDHSDMHMGDGDDTCSMN MLFSWSYKNTCVVFEWWHIKTLPGLILSCLAIFGLAYLYEYLKYCVHKRQLSQRVLLPNR SLTKINQADKVSNSILYGLQVGFSFMLMLVFMTYNGWLMLAVVCGAIWGNYSWCTSYSPE IDDSSLACH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glycoprotein Hormones Alpha Chain (Cga) Elisa Kit
EKC42429 96 Tests

Human Glycoprotein Hormones Alpha Chain (Cga) Elisa Kit

Sign In for Pricing
View Details
SHC1 polyclonal antibody
BS78913-01 50 µL

SHC1 polyclonal antibody

Sign In for Pricing
View Details
SHC1 polyclonal antibody
BS78913-02 100 µL

SHC1 polyclonal antibody

Sign In for Pricing
View Details
Fungiqual
MBS5781474 Inquire

Fungiqual

Sign In for Pricing
View Details
DOPE-PEG-Amine (MW 5000)
TCL-00994-01 100 mg

DOPE-PEG-Amine (MW 5000)

Sign In for Pricing
View Details
DOPE-PEG-Amine (MW 5000)
TCL-00994-02 250 mg

DOPE-PEG-Amine (MW 5000)

Sign In for Pricing
View Details