Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Potassium-transporting ATPase C chain (kdpC)

This Recombinant Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

A4G5J7

Expression Region

1-190

Origin

Herminiimonas arsenicoxydans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSTLRPALVLFAVLTLICGVIYPYAITGIGKLAFSEQAEGSLVSRNGQIVGSSLIGQAF SSPQYFWGRPSATSPMPNNAAASSGSNQGPLNLALIDSVKGRIAALKAADPANTLPVPVD LVTASASGLDPEISLAAAKYQAARIALARKMQLEEVQSIIDRHSKAQYFGFFGEPRVNVL ALNLALDQHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHBDF2 (NM_001005498) Human Tagged Lenti ORF Clone
RC214964L4 10 µg

RHBDF2 (NM_001005498) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD168 Polyclonal Antibody
RA22955-01 50 µL

CD168 Polyclonal Antibody

Sign In for Pricing
View Details
CD168 Polyclonal Antibody
RA22955-02 100 µL

CD168 Polyclonal Antibody

Sign In for Pricing
View Details
Miz1 Antibody
orb1313555 100 µL

Miz1 Antibody

Sign In for Pricing
View Details
OPTN (Optineurin, NRP, FIP2, Huntingtin-interacting Protein 7, HIP7, HYPL, ALS12, GLC1E, TFIIIA-IntP) (HRP)
MBS6430185-01 0.1 mL

OPTN (Optineurin, NRP, FIP2, Huntingtin-interacting Protein 7, HIP7, HYPL, ALS12, GLC1E, TFIIIA-IntP) (HRP)

Sign In for Pricing
View Details
OPTN (Optineurin, NRP, FIP2, Huntingtin-interacting Protein 7, HIP7, HYPL, ALS12, GLC1E, TFIIIA-IntP) (HRP)
MBS6430185-02 5x 0.1 mL

OPTN (Optineurin, NRP, FIP2, Huntingtin-interacting Protein 7, HIP7, HYPL, ALS12, GLC1E, TFIIIA-IntP) (HRP)

Sign In for Pricing
View Details