Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii Potassium-transporting ATPase C chain (kdpC)

This Recombinant Cronobacter sakazakii Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

A7MQV0

Expression Region

1-190

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMLRPALTLLVFLTILTGGVYPLATTVLGQWWFKDQAEGSLIRQHDEVRGSRLIGQAFS EAKYFQGRPSATAEAPYNPMASGGSNLAASNPALDKEVQARVQALRAANPDARAAVPVEL VTASASGLDYGITPDAAFWQAPRVAQARGISEAEVGRLIRENTDAPLAGFLGQPVVNVLK LNMALDALQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyridine-2,6-d2
TRC-P998912-10MG 10 mg

Pyridine-2,6-d2

Sign In for Pricing
View Details
Mif (BC024895) Mouse Tagged ORF Clone
MG200478 10 µg

Mif (BC024895) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ULk3 Mouse Gene Knockout Kit (CRISPR)
KN518693 1 Kit

ULk3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Nid1 activation kit by CRISPRa
GA202902 1 Kit

Mouse Nid1 activation kit by CRISPRa

Sign In for Pricing
View Details
Block, 24 x 0.5ml centrifuge tubes
BSW05 1 Each

Block, 24 x 0.5ml centrifuge tubes

Sign In for Pricing
View Details
Streptavidin, CF®555 Conjugate
#29038 1x 1 mg

Streptavidin, CF®555 Conjugate

Sign In for Pricing
View Details