Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RING finger protein 183 (Rnf183)

This Recombinant Mouse RING finger protein 183 (Rnf183) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

RING finger protein 183

UniProt

Q8QZS5

Expression Region

1-190

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQGQELRAECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHLSLVTPARRRLLCPLCR QPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDL GAEPGSQTGLPQDTAPDTRPVPIPSHYSLRECVRNPHFRIFAYLMAVILSVTLLLIFSIF WTKQFFWGMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr89 (NM_001014078) Rat Tagged ORF Clone Lentiviral Particle
RR214735L4V 200 µL

Wdr89 (NM_001014078) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
UIP1 (C-2) Alexa Fluor® 647
sc-393259 AF647 200 µg/mL

UIP1 (C-2) Alexa Fluor® 647

Sign In for Pricing
View Details
Lentiviral human POGLUT2 shRNA (UAS) - Lentiviral human POGLUT2 shRNA (UAS, RFP) (25)
GTR15130715 1 Vial

Lentiviral human POGLUT2 shRNA (UAS) - Lentiviral human POGLUT2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Triptinin B
orb1681537 25 mg

Triptinin B

Sign In for Pricing
View Details
Anti-NLRP3 (Recombinant Rabbit, Monoclonal, IgG)
A117282 100 µL

Anti-NLRP3 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
Anti-Bacteriophage H19B stxB/SLT-1b/VT1 Nanobody (7-3#)
RVV30602 100 μg

Anti-Bacteriophage H19B stxB/SLT-1b/VT1 Nanobody (7-3#)

Sign In for Pricing
View Details