Recombinant Jannaschia sp. ATP synthase subunit b (atpF)
This Recombinant Jannaschia sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-190.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
Q28UC5
Expression Region
1-190
Origin
Jannaschia sp. (strain CCS1)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MRYLTALFVLVASPALAAGDDAPKGLFNPSLGNTDFVVLLGFLLFLAILFYFGVPKMLGG MLDARAEGIRSELDEARALREEAQTLLASYERKAREVEEQSARIVTEARANAETAAEQAK ADIERSITRRLAAAEDQIASAEAKASRAVRDTAASVAVAAAAEVIAGGTSATDQNKMIDE AIEEVGRQLH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042848-500 1x 500 µL
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041045-100 1x 100 µL
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472397-500 1x 500 µL
CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details