Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii High affinity copper uptake protein 1 (SLC31A1)

This Recombinant Pongo abelii High affinity copper uptake protein 1 (SLC31A1) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

High affinity copper uptake protein 1, Copper transporter 1, Solute carrier family 31 member 1

UniProt

Q5RAS6

Expression Region

1-190

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSRGGGDSSMMMMPMTFYFGFKNVELLFSG LVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETH KTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKA VVVDITEHCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7 (NM_000971) Human Over-expression Lysate
LY424418 100 µg

RPL7 (NM_000971) Human Over-expression Lysate

Sign In for Pricing
View Details
WIBG (PYM1) Mouse Monoclonal Antibody [Clone ID: OTI2C1]
CF806605 100 µg

WIBG (PYM1) Mouse Monoclonal Antibody [Clone ID: OTI2C1]

Sign In for Pricing
View Details
DRG2 (NM_001388) Human Over-expression Lysate
LC419961 20 µg

DRG2 (NM_001388) Human Over-expression Lysate

Sign In for Pricing
View Details
Cycloxygenase-2 (COX-2) (COX2/3232R), CF405S conjugate, 0.1mg/mL
BNC043232-100 1x 100 µL

Cycloxygenase-2 (COX-2) (COX2/3232R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ZNF780B activation kit by CRISPRa
GA116079 1 Kit

Human ZNF780B activation kit by CRISPRa

Sign In for Pricing
View Details
TMPPE (NM_001039770) Human Recombinant Protein
TP315414M 100 µg

TMPPE (NM_001039770) Human Recombinant Protein

Sign In for Pricing
View Details