Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 11, mitochondrial (Tmem11)

This Recombinant Mouse Transmembrane protein 11, mitochondrial (Tmem11) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Transmembrane protein 11, mitochondrial, Protein PM1

UniProt

Q8BK08

Expression Region

1-190

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAWGRRRLGPGGGGSRERVSLSATDCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVI EPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLY GISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYC VKKVYELYAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LZTS2 Human Gene Knockout Kit (CRISPR)
KN400824 1 Kit

LZTS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cfap298 Mouse Gene Knockout Kit (CRISPR)
KN500014 1 Kit

Cfap298 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PHF12 Antibody
OC-428-01 50 μL

PHF12 Antibody

Sign In for Pricing
View Details
PHF12 Antibody
OC-428-02 100 µL

PHF12 Antibody

Sign In for Pricing
View Details
PHF12 Antibody
OC-428-03 1 mL

PHF12 Antibody

Sign In for Pricing
View Details
Osteocalcin (BGLAP) (C-term)/(C-term C80) Rabbit Polyclonal Antibody
AP50371PU-N 400 µL

Osteocalcin (BGLAP) (C-term)/(C-term C80) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details