Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 11, mitochondrial (Tmem11)

This Recombinant Mouse Transmembrane protein 11, mitochondrial (Tmem11) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Transmembrane protein 11, mitochondrial, Protein PM1

UniProt

Q8BK08

Expression Region

1-190

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAWGRRRLGPGGGGSRERVSLSATDCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVI EPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLY GISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYC VKKVYELYAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SREBP1 (SREBP1/1578), 0.2mg/mL
BNUB1578-100 1x 100 µL

SREBP1 (SREBP1/1578), 0.2mg/mL

Sign In for Pricing
View Details
Transcription Factor SP9 (SP9) (NM_001145250) Human Over-expression Lysate
LY428761 100 µg

Transcription Factor SP9 (SP9) (NM_001145250) Human Over-expression Lysate

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3540), CF740 conjugate, 0.1mg/mL
BNC743540-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3540), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DECR2 Antibody
8C17620-AAT 50 µg

DECR2 Antibody

Sign In for Pricing
View Details
STING Recombinant Rabbit monoclonal Antibody
HA751165 100 µL

STING Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Sncb Mouse Gene Knockout Kit (CRISPR)
KN516383 1 Kit

Sncb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details