Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Potassium-transporting ATPase C chain (kdpC)

This Recombinant Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

Q8FJV5

Expression Region

1-190

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGLRPALSTFLFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNFT GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAALRAANPDASTNVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS3P5 3'UTR Luciferase Stable Cell Line
TU021782 1.0 mL

RPS3P5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Transmembrane 6 superfamily member 1 (TM6SF1) ELISA Kit
KTE60303-01 48 Tests

Human Transmembrane 6 superfamily member 1 (TM6SF1) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane 6 superfamily member 1 (TM6SF1) ELISA Kit
KTE60303-02 96 Tests

Human Transmembrane 6 superfamily member 1 (TM6SF1) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane 6 superfamily member 1 (TM6SF1) ELISA Kit
KTE60303-03 5x 96 Tests

Human Transmembrane 6 superfamily member 1 (TM6SF1) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane 6 superfamily member 1 (TM6SF1) ELISA Kit
KTE60303-04 50x 96 Tests

Human Transmembrane 6 superfamily member 1 (TM6SF1) ELISA Kit

Sign In for Pricing
View Details
Human LILRB2 siRNA
abx922560-01 15 nmol

Human LILRB2 siRNA

Sign In for Pricing
View Details