Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Potassium-transporting ATPase C chain (kdpC)

This Recombinant Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

Q8X9G0

Expression Region

1-190

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGLRPALSTFIFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNFT DNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPNASTSVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polr3g ORF Vector (Mouse) (pORF)
37197014 1.0 µg DNA

Polr3g ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Gba3 (NM_001106010) Rat Tagged ORF Clone
RR211678 10 µg

Gba3 (NM_001106010) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Human Apelin 12 (AP12) ELISA Kit
MBS9308424-01 48 Well

Human Apelin 12 (AP12) ELISA Kit

Sign In for Pricing
View Details
Human Apelin 12 (AP12) ELISA Kit
MBS9308424-02 96 Well

Human Apelin 12 (AP12) ELISA Kit

Sign In for Pricing
View Details
Human Apelin 12 (AP12) ELISA Kit
MBS9308424-03 5x 96 Well

Human Apelin 12 (AP12) ELISA Kit

Sign In for Pricing
View Details
Human Apelin 12 (AP12) ELISA Kit
MBS9308424-04 10x 96 Well

Human Apelin 12 (AP12) ELISA Kit

Sign In for Pricing
View Details