Recombinant Rat Selenoprotein S (Sels)
This Recombinant Rat Selenoprotein S (Sels) spans the amino acid sequence from region 1-190.
Product Specifications
Product Name Alternative
Selenoprotein S, SelS, Sg2, VCP-interacting membrane protein
UniProt
Q8VHV8
Expression Region
1-190
Origin
Rattus norvegicus (Rat)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDRGEEPMSARPALETESLRFLHVTVGSLLASYGWYILFSCVLLYIVIQKLSLRLRALRQ RQLDQAEAVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKQRQLEEEKRRQKIEMWD SMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPG RRGPSSGGUS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP3-13713 100 µL
Rabbit Monoclonal Influenza B nucleoprotein Antibody (HL1073) - (B/Taiwan/753/2005)
Sign In for Pricing
View Details GTR15353106 1 Vial
Lentiviral human BTG2 shRNA (UAS) - Lentiviral human BTG2 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
MBS6142834-01 0.1 mL
MARCH9 (E3 Ubiquitin-protein Ligase MARCH9, Membrane-associated RING Finger Protein 9, Membrane-associated RING-CH Protein IX, MARCH-IX, RING Finger Protein 179, RNF179, FLJ36578, MARCH-IX) (Biotin)
Sign In for Pricing
View Details