Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Selenoprotein S (Sels)

This Recombinant Rat Selenoprotein S (Sels) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Selenoprotein S, SelS, Sg2, VCP-interacting membrane protein

UniProt

Q8VHV8

Expression Region

1-190

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRGEEPMSARPALETESLRFLHVTVGSLLASYGWYILFSCVLLYIVIQKLSLRLRALRQ RQLDQAEAVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKQRQLEEEKRRQKIEMWD SMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPG RRGPSSGGUS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC00324 Human shRNA Plasmid Kit (Locus ID 284029)
TR318247 1 Kit

LINC00324 Human shRNA Plasmid Kit (Locus ID 284029)

Sign In for Pricing
View Details
Rabbit Omega 6 Fatty Acid ELISA kit
GTR10372706 96 Well

Rabbit Omega 6 Fatty Acid ELISA kit

Sign In for Pricing
View Details
Recombinant Human CERS2 Protein, N-His-SUMO
HP591012-01 50 µg

Recombinant Human CERS2 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human CERS2 Protein, N-His-SUMO
HP591012-02 100 µg

Recombinant Human CERS2 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human CERS2 Protein, N-His-SUMO
HP591012-03 1 mg

Recombinant Human CERS2 Protein, N-His-SUMO

Sign In for Pricing
View Details
STXBP3 siRNA (Human)
CRH4659-01 15 nmol

STXBP3 siRNA (Human)

Sign In for Pricing
View Details