Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Potato mop-top virus Movement protein TGB3

This Recombinant Potato mop-top virus Movement protein TGB3 spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Movement protein TGB3, P21, Triple gene block 3 protein, TGBp3

UniProt

Q9IV52

Expression Region

1-190

Origin

Potato mop-top virus (isolate Potato/Sweden/Sw) (PMTV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPPVILHSPNCSCQFCSSELPSTHTCGSQDRTVPLHVEATAAGHMEAKNFSLQYVLLVA FVSVLLGFSFCVYLKSMSNDEASDMTYYYQDLNSVEIKLGKNPLDPEVIKAIHSFQEFPY GNIPSIRREAEFDVQNDESSAVVLSGSNNNRRQVASTPCENNVLLKLWKDDLSFTIIAVT VLVGAMLARC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-100 1x 100 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD1 / PDCD1 / CD279 (PDCD1/922), CF740 conjugate, 0.1mg/mL
BNC740922-500 1x 500 µL

PD1 / PDCD1 / CD279 (PDCD1/922), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details