Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Hyaluronan synthase 3 (HAS3)

This Recombinant Chicken Hyaluronan synthase 3 (HAS3) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Hyaluronan synthase 3, EC= 2.4.1.212, Hyaluronate synthase 3, Hyaluronic acid synthase 3, CHAS3, HA synthase 3

UniProt

O57425

Expression Region

1-190

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SYFGCVQCISGPLGMYRNTLLQQFLEDWYHQTFLGTKCSFGDDRHLTNRVLSLGYQTKYT PRSRCLTETPTRYLRWLNQQTRWSKSYFREWLYNALWFHKHHLWMTYESVVTGFFPFFLI ATVIQLFYRGRIWNILLFLLTVQLVGIIKATYACFLRGSAEMIFVSLYALLYMSSLLPAK MFAIATINKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

eRF1 (ETF1) Human Gene Knockout Kit (CRISPR)
KN420387 1 Kit

eRF1 (ETF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IMPDH1 (NM_183243) Human Recombinant Protein
TP307118 20 µg

IMPDH1 (NM_183243) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human AgRP/AGRP Protein (His Tag)
PKSH031894 50 µg

Recombinant Human AgRP/AGRP Protein (His Tag)

Sign In for Pricing
View Details
Zoloperone
TRC-Z650038-50MG 50 mg

Zoloperone

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF740 conjugate, 0.1mg/mL
BNC741389-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MZ2E/838), CF640R conjugate, 0.1mg/mL
BNC400838-100 1x 100 µL

MAGE A1 (MZ2E/838), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details