Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Hyaluronan synthase 3 (has3)

This Recombinant Xenopus laevis Hyaluronan synthase 3 (has3) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Hyaluronan synthase 3, EC= 2.4.1.212, Hyaluronate synthase 3, Hyaluronic acid synthase 3, HA synthase 3, xHAS3

UniProt

O57426

Expression Region

1-190

Origin

Xenopus laevis (African clawed frog)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SYFGCVQCISGPLGMYRNSLLQYFLEDWYHQTFLGQKCSFGDDRHLTNRVLSMGFRTKYT ARSRCLTETPTRYLRWLNQQTRWSKSYFREWLYNALWFHKHHLWMTYESVVTGFFPFFLV ATVVQLFYRGRVWNILLFLLTVQLVGILKATYACILRGNAEMIFMSLYSLLYMTSLLPAK IFAVITINKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serum Amyloid A (SAA/326), Biotin conjugate, 0.1mg/mL
BNCB0326-500 1x 500 µL

Serum Amyloid A (SAA/326), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTR Antibody
OC-115-01 50 μL

TTR Antibody

Sign In for Pricing
View Details
TTR Antibody
OC-115-02 100 µL

TTR Antibody

Sign In for Pricing
View Details
TTR Antibody
OC-115-03 1 mL

TTR Antibody

Sign In for Pricing
View Details
Pregnanediol 20-O-Acetate 3Alpha-O-Beta-D-Glucuronide Sodium Salt
TRC-P705145-5MG 5 mg

Pregnanediol 20-O-Acetate 3Alpha-O-Beta-D-Glucuronide Sodium Salt

Sign In for Pricing
View Details
Human SPAG8 activation kit by CRISPRa
GA108796 1 Kit

Human SPAG8 activation kit by CRISPRa

Sign In for Pricing
View Details