Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc punctiforme ATP synthase subunit b (atpF)

This Recombinant Nostoc punctiforme ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B2J056

Expression Region

1-190

Origin

Nostoc punctiforme (strain ATCC 29133 / PCC 73102)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIMGTFLLLAAEANAVHSELAEGAAEGGFGLNLDIFETNLINLAILVGILFYFGRKVLS NILNERQSNIATAIQEAEGRLKEAKTALSQAQEQLKQSQAEAERIRQSAVENAQKAKEAL LAKAVQDVERLKQTAAADLNTETERAIAQLRQRVATLALQKVESQLKGGIADDAQQSLID RSIAQLGGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUAK2 Protein Vector (Human) (pPM-C-HA)
32260021 500 ng

NUAK2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
3- (Piperidin-4-yl) propan-1-ol hydrochloride
OR1053340-01 1 g

3- (Piperidin-4-yl) propan-1-ol hydrochloride

Sign In for Pricing
View Details
3- (Piperidin-4-yl) propan-1-ol hydrochloride
OR1053340-02 5 g

3- (Piperidin-4-yl) propan-1-ol hydrochloride

Sign In for Pricing
View Details
3- (Piperidin-4-yl) propan-1-ol hydrochloride
OR1053340-03 25 g

3- (Piperidin-4-yl) propan-1-ol hydrochloride

Sign In for Pricing
View Details
UST shRNA Plasmid (h)
sc-95159-SH 20 µg

UST shRNA Plasmid (h)

Sign In for Pricing
View Details
SOX9 Rabbit Polyclonal Antibody
E10G04662 100 µL

SOX9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details