Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

A2C3V3

Expression Region

1-191

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSESKSSQSEKELSGLVLEQKIKGSRKVSNYLVASMLSIGGVGFLLASFSSYFGRDFLP LGNPSTLIFVPQGLVMGLYGLAAFLLAIYFWRLINIDYGSGVNRFDKNKGVLSLSRRGLF KNIEIEIPIDEIKAVKLEVREGFNPLRRVSLRIKGRKDLPISRVGSPKPLLDLENEGAEI ARFLEVNLEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human USP17L18 siRNA
abx939164-01 15 nmol

Human USP17L18 siRNA

Sign In for Pricing
View Details
Human USP17L18 siRNA
abx939164-02 30 nmol

Human USP17L18 siRNA

Sign In for Pricing
View Details
Glutamate Decarboxylase 65,67 (GAD 65,67) (FITC)
MBS6478168-01 0.1 mL

Glutamate Decarboxylase 65,67 (GAD 65,67) (FITC)

Sign In for Pricing
View Details
Glutamate Decarboxylase 65,67 (GAD 65,67) (FITC)
MBS6478168-02 5x 0.1 mL

Glutamate Decarboxylase 65,67 (GAD 65,67) (FITC)

Sign In for Pricing
View Details
Feline Leukemia Virus, p15E (FeLV) (APC)
MBS6268785-01 0.1 mL

Feline Leukemia Virus, p15E (FeLV) (APC)

Sign In for Pricing
View Details
Feline Leukemia Virus, p15E (FeLV) (APC)
MBS6268785-02 5x 0.1 mL

Feline Leukemia Virus, p15E (FeLV) (APC)

Sign In for Pricing
View Details