Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

A2C3V3

Expression Region

1-191

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSESKSSQSEKELSGLVLEQKIKGSRKVSNYLVASMLSIGGVGFLLASFSSYFGRDFLP LGNPSTLIFVPQGLVMGLYGLAAFLLAIYFWRLINIDYGSGVNRFDKNKGVLSLSRRGLF KNIEIEIPIDEIKAVKLEVREGFNPLRRVSLRIKGRKDLPISRVGSPKPLLDLENEGAEI ARFLEVNLEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC 10 Blocking Peptide
33R-10525 50 ug

HDAC 10 Blocking Peptide

Sign In for Pricing
View Details
EGR2 Rabbit Polyclonal Antibody (APC)
orb2574867 100 µg

EGR2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
DIP2C Rabbit pAb
E45R29513N-100 100 µL

DIP2C Rabbit pAb

Sign In for Pricing
View Details
ZSWIM2, CT (ZSWIM2, ZZZ2, E3 ubiquitin-protein ligase ZSWIM2, MEKK1-related protein X, ZZ-type zinc finger-containing protein 2, Zinc finger SWIM domain-containing protein 2) (MaxLight 490) discontinued
044422-ML490 100 µL

ZSWIM2, CT (ZSWIM2, ZZZ2, E3 ubiquitin-protein ligase ZSWIM2, MEKK1-related protein X, ZZ-type zinc finger-containing protein 2, Zinc finger SWIM domain-containing protein 2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Betacellulin, Mouse (HEK 293-expressed)
Z03162-10 10 µg

Betacellulin, Mouse (HEK 293-expressed)

Sign In for Pricing
View Details
Rabbit Polyclonal TCF-3/E2A Antibody [Alexa Fluor 647]
NBP1-77119AF647 0.1 mL

Rabbit Polyclonal TCF-3/E2A Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details