Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

A2C3V3

Expression Region

1-191

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSESKSSQSEKELSGLVLEQKIKGSRKVSNYLVASMLSIGGVGFLLASFSSYFGRDFLP LGNPSTLIFVPQGLVMGLYGLAAFLLAIYFWRLINIDYGSGVNRFDKNKGVLSLSRRGLF KNIEIEIPIDEIKAVKLEVREGFNPLRRVSLRIKGRKDLPISRVGSPKPLLDLENEGAEI ARFLEVNLEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Mouse Cyclin G1 Pab
165198 100 µg

Anti Mouse Cyclin G1 Pab

Sign In for Pricing
View Details
Comb (15 well / 34 well)
A-7020-3-3 1 Unit

Comb (15 well / 34 well)

Sign In for Pricing
View Details
Recombinant Human ARL2BP Protein, N-His
orb2965386-01 50 µg

Recombinant Human ARL2BP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ARL2BP Protein, N-His
orb2965386-02 100 µg

Recombinant Human ARL2BP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ARL2BP Protein, N-His
orb2965386-03 1 mg

Recombinant Human ARL2BP Protein, N-His

Sign In for Pricing
View Details
SNORD115-5 sgRNA CRISPR Lentivector (Human) (Target 1)
K2241902 1.0 µg DNA

SNORD115-5 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details