Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bradyrhizobium sp. ATP synthase subunit b' (atpG)

This Recombinant Bradyrhizobium sp. ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

A4Z2B6

Expression Region

1-191

Origin

Bradyrhizobium sp. (strain ORS278)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAESHGEAKGGEAKGTASAHTEAEGGHGFPPFQKETFPSQIASLVIAFVALYVIVSRVAL PKVGAVIDARQKSIDGDLAEAQRLKDESEAAMKAYETELATARARAQAIGAETRDKLAAS SEAERKALEDSLAAKLAAAETSIASTRATAMSNVRGIAADAASAIVQQLTGKAPAAKTVE AAVDASLKGTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2921), CF568 conjugate, 0.1mg/mL
BNC682921-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2921), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tfcp2l1 Mouse Gene Knockout Kit (CRISPR)
KN517463 1 Kit

Tfcp2l1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Urinary bladder
CS645917 5x 5 µm

Frozen Tissue Sections, Urinary bladder

Sign In for Pricing
View Details
Frozen Tissue Blocks, Cervix
CB502767 1 Block

Frozen Tissue Blocks, Cervix

Sign In for Pricing
View Details
GABA A Receptor gamma 2 (GABRG2) (NM_198904) Human Over-expression Lysate
LY403697 100 µg

GABA A Receptor gamma 2 (GABRG2) (NM_198904) Human Over-expression Lysate

Sign In for Pricing
View Details
RUNDC1 Human qPCR Primer Pair (NM_173079)
HP218272 200 Reactions

RUNDC1 Human qPCR Primer Pair (NM_173079)

Sign In for Pricing
View Details