Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bradyrhizobium sp. ATP synthase subunit b' (atpG)

This Recombinant Bradyrhizobium sp. ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

A4Z2B6

Expression Region

1-191

Origin

Bradyrhizobium sp. (strain ORS278)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAESHGEAKGGEAKGTASAHTEAEGGHGFPPFQKETFPSQIASLVIAFVALYVIVSRVAL PKVGAVIDARQKSIDGDLAEAQRLKDESEAAMKAYETELATARARAQAIGAETRDKLAAS SEAERKALEDSLAAKLAAAETSIASTRATAMSNVRGIAADAASAIVQQLTGKAPAAKTVE AAVDASLKGTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2.2 (NX2/294), Biotin conjugate, 0.1mg/mL
BNCB0294-100 1x 100 µL

NKX2.2 (NX2/294), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-(+)-Malic Acid
TRC-M159500-250G 250 g

D-(+)-Malic Acid

Sign In for Pricing
View Details
IFluor® 790-Wheat Germ Agglutinin (WGA) Conjugate
25563-AAT 1 mg

IFluor® 790-Wheat Germ Agglutinin (WGA) Conjugate

Sign In for Pricing
View Details
AMSH (STAMBP) (C-term) Rabbit Polyclonal Antibody
AP54063PU-N 400 µL

AMSH (STAMBP) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MOBK1B (MOB1A) activation kit by CRISPRa
GA110629 1 Kit

Human MOBK1B (MOB1A) activation kit by CRISPRa

Sign In for Pricing
View Details
FLRT1 (NM_013280) Human Recombinant Protein
TP720302L 500 µg

FLRT1 (NM_013280) Human Recombinant Protein

Sign In for Pricing
View Details