Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bradyrhizobium sp. ATP synthase subunit b' (atpG)

This Recombinant Bradyrhizobium sp. ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

A4Z2B6

Expression Region

1-191

Origin

Bradyrhizobium sp. (strain ORS278)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAESHGEAKGGEAKGTASAHTEAEGGHGFPPFQKETFPSQIASLVIAFVALYVIVSRVAL PKVGAVIDARQKSIDGDLAEAQRLKDESEAAMKAYETELATARARAQAIGAETRDKLAAS SEAERKALEDSLAAKLAAAETSIASTRATAMSNVRGIAADAASAIVQQLTGKAPAAKTVE AAVDASLKGTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Allium sativum Lectin (Garlic) -ASA-,  10nm
GP-8007-10 1 mL

Colloidal Gold Conjugated Allium sativum Lectin (Garlic) -ASA-, 10nm

Sign In for Pricing
View Details
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA374308 100 µL

Caveolin 1 (CAV1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF496 activation kit by CRISPRa
GA113713 1 Kit

Human ZNF496 activation kit by CRISPRa

Sign In for Pricing
View Details
PAX6 (PAX6/1166), CF594 conjugate, 0.1mg/mL
BNC941166-500 1x 500 µL

PAX6 (PAX6/1166), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAIAP2L1 Rabbit Polyclonal Antibody
TA373920 100 µL

BAIAP2L1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CIITA (NM_000246) Human Over-expression Lysate
LC424845 20 µg

CIITA (NM_000246) Human Over-expression Lysate

Sign In for Pricing
View Details