Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium vitis Potassium-transporting ATPase C chain (kdpC)

This Recombinant Agrobacterium vitis Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

B9K2I1

Expression Region

1-191

Origin

Agrobacterium vitis (strain S4 / ATCC BAA-846) (Rhizobium vitis (strain S4) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSHLRPAITMTVLFTGLCGLAYPLAITGVAQAVLPAQANGSIVTKGDAVVGSALIGQAF TSPRYFASRPSATSNSPYNPLASGGTNLGATSQKLKDQIAAAVTAWQANGRSGPVPADAV TSSASGLDPDISPENARQQVALVAKARNMPEKDVAALVEAQVQPRLLGVIGEPRVNVLRL NMALDAAGATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ViaTagTM 355/450 Haloalkane Ligand, 1000X in DMSO
#10301 1x 30 µL

ViaTagTM 355/450 Haloalkane Ligand, 1000X in DMSO

Sign In for Pricing
View Details
Mercury(II) Acetate
TRC-M225490-50G 50 g

Mercury(II) Acetate

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS800700 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
ZDHHC11 (NM_024786) Human Recombinant Protein
TP304383L 1 mg

ZDHHC11 (NM_024786) Human Recombinant Protein

Sign In for Pricing
View Details
CD95 / FAS / TNFRSF6 (FAS/3588), CF640R conjugate, 0.1mg/mL
BNC403588-100 1x 100 µL

CD95 / FAS / TNFRSF6 (FAS/3588), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vamp5 Mouse Gene Knockout Kit (CRISPR)
KN518846 1 Kit

Vamp5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details