Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q46JS1

Expression Region

1-191

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSESKLSQSEKELSGLVLEQKIKGSRKVSNYLVASMLSIGGVGFLLASFSSYFGRDFLP LGNPSTLIFVPQGLVMGLYGVAAFLLAIYFWRLINIDYGSGVNRFDKNKGVLSLSRRGLF KNIEIEIPIDEIKAVKLEVREGFNPLRRVSLRIKGRKDLPISRVGSPQPLLDLENEGAEI ARFLEVNLEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibulin 7 Rabbit pAb
E47R13161 100 µL

Fibulin 7 Rabbit pAb

Sign In for Pricing
View Details
Sheep Matrin 3 ELISA Kit
MBS078430-01 48 Well

Sheep Matrin 3 ELISA Kit

Sign In for Pricing
View Details
Sheep Matrin 3 ELISA Kit
MBS078430-02 96 Well

Sheep Matrin 3 ELISA Kit

Sign In for Pricing
View Details
Sheep Matrin 3 ELISA Kit
MBS078430-03 5x 96 Well

Sheep Matrin 3 ELISA Kit

Sign In for Pricing
View Details
Sheep Matrin 3 ELISA Kit
MBS078430-04 10x 96 Well

Sheep Matrin 3 ELISA Kit

Sign In for Pricing
View Details
Sub1-set siRNA/shRNA/RNAi Lentivector (Rat)
45818096 4x 500 ng

Sub1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details