Recombinant Acidothermus cellulolyticus ATP synthase subunit b (atpF)
This Recombinant Acidothermus cellulolyticus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-191.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
A0LSL2
Expression Region
1-191
Origin
Acidothermus cellulolyticus (strain ATCC 43068 / 11B)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPPRTLADNFLVPGPTAIAELIVFLLILFIFGKYIVPFVNQKLAERQELIRSQFEEAKRA RDEAEAAAAEYRAQLQEIRAEATRVRERAHEEGQQIIAEMKEQARREADRIVRAAEEQIQ AERARAVAAVRAEVGSLAVELASRIVGESLADVERQHRIVERFLAELEERAQRQPAASDV VGGQQREEVHR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400262-500 1x 500 µL
Human Lambda Light Chain (HP6054), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details