Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1)

This Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

Apoptosis regulator BHRF1, Early antigen protein R, EA-R, Nuclear antigen

UniProt

P0C6Z1

Expression Region

1-191

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIER NSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQS TPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVI CSYLFISRGRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,6-Dinitropyrene
TRC-D263580-5MG 5 mg

1,6-Dinitropyrene

Sign In for Pricing
View Details
Human SFRS15 (SCAF4) activation kit by CRISPRa
GA111511 1 Kit

Human SFRS15 (SCAF4) activation kit by CRISPRa

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF647 conjugate, 0.1mg/mL
BNC470902-500 1x 500 µL

Nucleolin (NCL/902), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATP6V1E2 Rabbit Polyclonal Antibody
TA369651 100 µL

ATP6V1E2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monic Acid A
TRC-M520500-50MG 50 mg

Monic Acid A

Sign In for Pricing
View Details
Prolactin Receptor (B6.2), CF568 conjugate, 0.1mg/mL
BNC680741-100 1x 100 µL

Prolactin Receptor (B6.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details