Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1)
This Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1) spans the amino acid sequence from region 1-191.
Product Specifications
Product Name Alternative
Apoptosis regulator BHRF1, Early antigen protein R, EA-R, Nuclear antigen
UniProt
P0C6Z1
Expression Region
1-191
Origin
Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)
Field of Research
Infectious Disease & Virology; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIER NSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQS TPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVI CSYLFISRGRH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2054-100 1x 100 µL
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), 0.2mg/mL
Sign In for Pricing
View Details 
BNC403777-100 1x 100 µL
Human Lambda Light Chain (B-Cell Marker) (rLLC/3777), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1561-500 1x 500 µL
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
