Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1)

This Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

Apoptosis regulator BHRF1, Early antigen protein R, EA-R, Nuclear antigen

UniProt

P0C6Z1

Expression Region

1-191

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIER NSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQS TPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVI CSYLFISRGRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pgp9.5 (UCHL-1) (13C4), CF555 conjugate, 0.1mg/mL
BNC550147-500 1x 500 µL

Pgp9.5 (UCHL-1) (13C4), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
AP20294PU-N 100 µg

Caspase 9 (CASP9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Podoplanin (PDPN) ELISA Kit
RDR-PDPN-Mu-01 96 Tests

Mouse Podoplanin (PDPN) ELISA Kit

Sign In for Pricing
View Details
Mouse Podoplanin (PDPN) ELISA Kit
RDR-PDPN-Mu-02 48 Tests

Mouse Podoplanin (PDPN) ELISA Kit

Sign In for Pricing
View Details
Cystathionase (CTH) (NM_001902) Human Over-expression Lysate
LY419669 100 µg

Cystathionase (CTH) (NM_001902) Human Over-expression Lysate

Sign In for Pricing
View Details
HEATR5B Human Gene Knockout Kit (CRISPR)
KN420610 1 Kit

HEATR5B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details