Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL165C (YGL165C)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL165C (YGL165C) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YGL165C

UniProt

P53106

Expression Region

1-192

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTYPVQPWTNFIIVYIYVYVYEWKNLSESRPDCQLAGRTNNRQYMYMYIYIDVQMHYCE CELCEDTCLYSSFNSLMENGMSISFSAVFVVVYALPVSLILTGSIDILGLCSSGSREAKS RLSMLSALISPFCRGGFKLGNVVVMSTSDERPFRPKRTSRSAIPRPLTCAASSFALLWHD PPFDFRLLFLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HspAI, 500U
RE1284 500 U

HspAI, 500U

Sign In for Pricing
View Details
Striatin 4 (STRN4) (N-term) Rabbit Polyclonal Antibody
AP54083PU-N 400 µL

Striatin 4 (STRN4) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Gastrokine 2 (GKN2) activation kit by CRISPRa
GA116351 1 Kit

Human Gastrokine 2 (GKN2) activation kit by CRISPRa

Sign In for Pricing
View Details
Nano Spectrophotometer BSNA-401
BSNA-401 Each

Nano Spectrophotometer BSNA-401

Sign In for Pricing
View Details
USP17L28 Human Gene Knockout Kit (CRISPR)
KN432925 1 Kit

USP17L28 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SGK1 Monoclonal Antibody
E-AB-22207-01 20 µL

SGK1 Monoclonal Antibody

Sign In for Pricing
View Details